1/7/2024 0 Comments Usps mailbox regulations![]() Note: Tabs cannot be put on the bottom of these mail pieces. OR both tabs may be placed on trailing edge with within 1 inch of the top and bottom edges. Oblong pieces: Weight up to 3 ounces, 1 tab is placed in the center of the top edge and 1 in the center of the trailing edge.The third tab must be on the lower leading edge and 1/2 inch away from the bottom. Quarter-fold: Weight up to 3 ounces requires three non-perforated tabs, one on the leading edge and one on the trailing edge within 1 inch of the top edges.Bi-fold and tri-fold: Weight up to 3 ounces requires two non-perforated tabs on the top edge of the piece within 1 inch of the edges.The number and size of tabs needed depend on the mail piece’s weight and design.Tabs can be made of paper, translucent paper, vinyl, or plastic.Below, we break down the USPS tabbing and gluing requirements. Die-cut shapes should be secured with tabs or glue spots/lines.īelow are the USPS tabbing regulations and general sealing standards for self-mailers.Īny folded self-mailer must follow the USPS’s regulations and be sealed with glue or tabs.All flaps must be secured by tabs or glue spots/lines.However, there are exceptions (see section 3.14. The flap’s folded edge must be in line with the top of the mail piece and finish 1 inch or more above the bottom edge.The flap must be at least 1-1/2 inches when measured from the top of the mail piece.Below are some basic standards and requirements for flaps: ![]() Some self-mailers have flaps, which are created when the last panel is folded over and attached to the unaddressed side of the piece. The last folded edge must be positioned at the bottom of the self-mailer unless it is an oblong piece. The back panels open edge must be at the top or within 1 inch of the top or around the edge of the mail piece. The non-address side or back of the mailer is the last folded panel of the mail piece. The outside panels produced by the fold must be equal or almost equal in size. You can have a maximum of 12 panels, but there are exceptions (see section 3.14.3 of the Postal Explorer.) Don’t forget to include the front and back. To get the total number of panels, count each two-sided section created by the folds to get one panel. Maximum weightĮvery self-mailer is made up of panels (the sections created when a sheet of paper is folded). 009 inch is okay if the height goes over 4-1/4 inches or if the length is greater than 6 inches. Minimum of 5 inches and a maximum of 10.5 inches. Minimum of 3.5 inches and a maximum of 6 inches. ![]() Now let’s break down the basic attributes of a self-mailer. Here, we’ll walk you through some self-mailer basics and then get into the nitty-gritty of USPS regulations for tabbing.Ī self-mailer is created with two or more panels, using one or more unbound sheets of paper that are folded together and sealed to make a letter-sized mailpiece. So, we put together a handy guide that breaks down all the specifics for tabbing requirements and shows what is acceptable for the mail stream. Staying up to date with the USPS’s regulations for folded self-mailers is tricky. Got questions about self-mailer tabs? We have answers!
0 Comments
![]() ![]() I then went ahead and registered my own service called IAnyService. Where you can see the same old divergent IDependencyResolver implementation for MVC here and WebApi here. I submit my cobbled together OWIN startup file for net452. The reason I have done this is because I want to understand how the dependencies and the consumer API works before we dive into, which is where the meat and potatoes of the cross runtime implementation might need to be implemented if we all agree on my suggested approach. My example is only using the nuget sans any Windsor container implementation. I did know that this could be used on netcore but did not for one second think about using it in a desktop clr scenario. My interest here was how we future proof Castle Windsor and create an implementation that services both dotnet core and desktop clr using OWIN because it is already available on both.Īll paths appear to be leading to Rome, or at least in this case. I have done some more investigation into this. ![]() I like the public API for BeginScope/EndScope because of it's simplicity, I am not particularly bound to the implementation of it, I just mentioned the current implementation to add more info to the discussion. I think there was significant work at play here to try and clean this up and to make lifestyle management a little easier in general and if Windsor doesn't have it you could "roll your own" in a very easy way, so I am glad you raised this issue. Pretty neat huh?ĭoes this support From what I can tell it does. This is a concept which allows you get these things from anywhere but you have to implement an IScopeAccessor. What if you need scopes in other There is an overload for LifestyleScoped whereby you can specify the type of an accessor. The default scope you mention( DefaultLifetimeScope) was only really a thing in the PerWebRequestLifestyleModule and the ThreadScopeAccessor. This is significant because when it tries to obtain the current scope for an instance it will return a CallContextLifetimeScope(the class based on remoting I mentioned earlier written by Kozmic himself). This is basically a shorthand API extension that will apply LifestyleType.Scoped to the config for that registration(using descriptors) which eventually ends up creating a ScopedLifestyleManager(commit: 4e7716e) in the DefaultKernel. I could not find the particular extension LifeTimeScoped but I am pretty sure you mean LifestyleScoped. Correct me if I'm wrong, but such middleware would use the default scope (i.e. 1/6/2024 0 Comments Cosmic eye watcher badge![]() Russia says they're done with ISS in 2024. I said to one of my colleagues, Dylan Taylor, "Did we really just explore the Titanic? It feels like a dream." He instantly replied, "Funny, I feel exactly the same way." Continue reading: Its Deep Diving Away Team Week. As the ship pulled into port my fellow Titanic explorers watched from railings above the ship's bridge. John's Newfoundland after exploring the RMS Titanic. 'Yesterday our mother ship ship Horizon Arctic finished the journey to carry us and our OceanGate Expeditions submersible Titan along the Grand Banks to port in St. Meanwhile I was rather blunt with all 384 million BBC World Service listeners with regard to the situation Russia has created for itself by invading Ukraine.Īlan Stern's Titanic Away Team Journal: Was That a Dream? I had to complain when it was sent to some media - but not others by NASA's crack PAO office. It took NASA PAO a full work day to send a "we know nothing" response with regard to Russia's latest announcement. NASA has not been made aware of decisions from any of the partners, though we are continuing to build future capabilities to assure our major presence in low-Earth orbit." Keith's note: I got this from NASA PAO at 5:11 pm EDT: "NASA is committed to the safe operation of the International Space Station through 2030, and is coordinating with our partners. NASAWatch on BBC World Service: Is Russia Leaving ISS?.UOvAcLmFrJ- NASA Watch July 27, 2022Ĭategories: Astrobiology, Space & Planetary Science ![]() "Two Ingenuity class helicopters will be used as back-ups to transfer samples to #Mars sample return ascent vehicle - #AstrobiologyįYI this redundancy option would not even be possible if John Grunsfeld had insisted that Ingenuity be sent to Mars. Ingenuity Comes To The Rescue Of Mars Sample Return In June, NASA raised the station's orbit using the U.S.-built Cygnus cargo spacecraft, a critical function that had been performed solely by the Russian section before." SpaceX's Crew Dragon means NASA no longer needs Russia for astronaut transportation. But Russia's role in this cooperation has receded lately. "You were getting this robustness, and everybody learned that there was another way of doing things," says Keith Cowing, editor of the NASA Watch news site and a former NASA manager who worked on station components in the early 1990s. "The real question is, what are the Russians going to leave behind if they just walk away from the station?" Cowing added."Ī Russian ISS exit could give NASA a hangover-then leave cosmonauts grounded, Fast Company Russia's war on Ukraine, and NASA no longer needing Russian rockets to send astronauts into orbit, has changed a long-running, uneasy, partnership in space, making it look less and less tenable. "The long isolation of ISS from geopolitics looks like it is regretfully coming to an end," said NASA Watch Editor Keith Cowing. ![]() Russia says it's leaving the International Space Station again. The assurance on Tuesday from Russia came after the newly appointed head of its space agency, Roscosmos, surprised NASA earlier in the day by announcing that Moscow intended to end more than two decades of partnership on the space station "after 2024." ![]() counterparts that Moscow expects to remain on the International Space Station at least until their own outpost in orbit is built in 2028, NASA's space operations chief told Reuters. Russia to NASA: Sticking with space station until at least 2028, Reuters ![]() Note that there is a complete drop-in replacement solution if pinball 2000 computer components were not repairable. The owner's game manual is a handy resource to have for general game operation, game settings & diagnostics, switch & lamp matrices, fuse lists, circuit boards and parts, playfield assemblies, some basic schematics, and wiring diagrams.īe aware that although rare, some factory documentation contains errors in schematics, wiring, switch/lamp matrices, and solenoid assignments.ĭetails for board and cabinet schematics and theory of operation guides for pinball 2000 games can be found in game manuals and the Schematic Manual. Schematics for each game are essential in tracing down connections to lamps, switches, and solenoids. * Denotes a game that was never produced 2.1 Recommended Documentation 2.1.1 Manuals & Schematics Only two games were released using the P2K platform, with 2 or 3 in development when Williams ceased production. The MediaGX did not sell well, and the boards and chips are now hard to find. Unfortunately, the software requires the Cyrix MediaGX CPU for its display. There are two proprietary components, the PRISM card, which contains the roms and booted the PC without a hard disk, and an audio amp. To be able to handle both the pinball and video aspects of the game, the designers of Pinball 2000 used a commercial off the shelf PC based on a unique graphics and CPU processor, the Cyrix MediaGX. This is known as the Pepper's Ghost effect. Using a 19" arcade monitor (CGA Resolution) and special playfield glass that is coated to reflect the image, it created the illusion of holographic images on the playfield. This system was a hybrid of conventional pinball with a video aspect. The reasons for why Williams ceased production are highly debated and more information can be found here. This was the last system used in a pinball machine before Williams ceased production of pinball machines. Pinball 2000 (P2K) was the answer to a failing pinball industry. 6.1 Light Saber on SW:E1 Will not Light.4.10.2 Modifying The Original Audio Amplifier.4.2.2 Power Supply Warning For Non-US Owners.4.2.1.2 Power Supply ATX to AT Adapter Method.4.2.1.1 Power Supply Modification Method.4.1 Entering and Viewing Bookkeeping and Diagnostics. ![]()
1/6/2024 0 Comments Scorpion barcode![]() Process ID: ARBCM3045-15 nucleotide sequence aataatatattttattttcgctatatgatcaggaataattggttcatctataagtttattaattcgaatagaattaagtcatccaggaatatgaattaataatgatcaaatttataattctttagtaactagacatgcatttttaataattttttttatagtaataccatttataattgggggatttggaaattacttaattccattaatactaggatcaccagatatagcttttcctcgaataaataatattagattttgacttttacctccatcattatttatattactattaagaaatttatttacacctaatgtaggaacaggatgaactgtttatcctcctttatcttcttatttatttcattcatctccatcaattgatattgcaatcttttctttacatatatcaggaatttcttctattattggatcattaaattttattgttactattttaataataaaaaatctttcattaaactatgatcaaattaatttattctcatgatcagtatgtattacagtaattttattaattttatctttaccagttttagctggagctattactatattactcttcgatcgaaattttaatacttcattctttgatccaataggaggaggagatccaattttatatcaacatttattt amino acid sequence mmyfifamwsgmigssmsllirmelshpgmwinndqiynslvtshaflmiffmvmpfmiggfgnyliplmlgspdmafprmnnisfwllppslfmlllsnlftpnvgtgwtvypplssylfhsspsidiaifslhmsgissiigslnfivtilmmknlslnydqinlfswsvcitvillilslpvlagaitmllfdrnfntsffdpmgggdpilyqhlf Here’s the barcode sequence information for this species: Photo Credit: CBG Photography Group, Centre for Biodiversity Genomics A Northern Scorpion, Paruroctonus boreus, with its elongated abdomen lying flat. #Canada150 #Biodiversity150 Specimen CCDB-28552-D04 – Okanagan County, British Columbia, Canada – 24-June-2009. Though scorpions have trouble focusing their eyes, they are some of the most light-sensitive eyes on the planet and allow them to navigate by the stars at night. Scorpions locate their enemies with sensory hairs found on their abdomens which allow them to strike accurately despite their poor vision. Despite their appearance, the scorpion ‘tail’ is not actually a tail, but an elongated abdomen curled above the rest of their body. Scorpions are venomous and use their stingers defensively to sting attackers. boreus glows under black light due to fluorescent compounds found in its exoskeleton and can be found in the field by using a hand-held UV lamp. Though a relatively common species, it is rarely seen due to its nocturnal nature. Paruroctonus boreus, or the Northern Scorpion, is native to British Columbia and Alberta and is the only species of scorpion found in Canada. ![]() Animalia: Arthropoda: Arachnida: Scorpiones: Vaejovidae: Paruroctonus: Paruroctonus boreus (Girard, 1854) 1/6/2024 0 Comments Putty for mac 8.5 1![]() User data is interspersed in-band with Telnet control information in an 8-bit byte oriented data connection over the Transmission Control Protocol (TCP). ![]() Telnet is a protocol used on the Internet or local area networks to provide a bidirectional interactive text-oriented communication facility using a virtual terminal connection. FTP users may authenticate themselves with a clear-text sign-in protocol, normally in the form of a username and password, but can connect anonymously if the server is configured to allow it. The File Transfer Protocol (FTP) is a standard network protocol used for the transfer of computer files between a client and server on a computer network.įTP is built on a client-server model architecture and uses separate control and data connections between the client and the server. WinOnMacs released Telnet FTP 2.2.1 for MacOS High Sierra and Mojave today. Purchase Putty 9.1.1 now and have Telnet SSH FTP SCP on your Mac made easy! Posted in News, Putty for Mac Tagged ftp, High Sierra, macos, mojave, Putty for Mac, sftp, ssh, telnet, terminal emulator Leave a comment WinOnMacs 30% off Summer Sale This store is very secure, simple and fast. We now use FastSpring as our preferred storefront, you can pay with Credit / Debit Cards, PayPal, Amazon payments, Wire Transfer etc. Our goal is to have native ports of essential Windows tools and applications made available for MacOS users. The only solution these developers face is to have access to both systems for testing which leads to increased infrastructure demands, and wasted project resources. There is a multitude of software developed only for the Windows operating system and even when software vendors port their applications to another platform, generally it lacks features that the Windows version contains. Putty also comes with a standard 14-day money back guarantee. A Subscription plan is also available that comes with one year of free upgrades. ![]() Also it is cool to use Putty as your SSH client if you are doing some Amazon AWS, VMware ESXi or CISCO Stuffs, transferring files, managing files on a server or whatever. Although you can use terminal for SSH connections still there are some benefits in using Putty such as Other clients don’t keep connections alive whereas Putty does. SSH is available by default in Mac and Linux or Unix. Official Versions of Putty are available on Unix like Platforms, and now it’s widely available for Mac systems running OSX 10.12.6 or higher. It Supports different types of Network Protocols such as SSH, FTP. In Windows it is used as SSH Client to connect to Your Linux server or for some other purpose But what will you do if you are on Mac? You might be thinking, Is there any Software like Putty for Mac Available? The answer is Yes! With the help of some other Software’s we can Use putty on MacOS although Putty is used widely on Windows Platform. Putty is one of the Best Terminal Emulators available today. It Supports different types of Network Protocols such as SSH, FTP, SCP, Telnet etc. Putty is one of the Best Terminal Emulators available today. Putty 9.1.1 is a minor release, Please see the full change-log below for all the changes in this release. WinOnMacs released Putty for Mac 9.1.1 for MacOS today. Be patient and keep trying otherwise, you may want to report the problem straight to the developers. On the bright side, the problem is server-side, and you’re not the only one affected. Back 4 Blood’s open beta will have some bugs, and this appears to be one of them. Practically speaking, you can fix the disconnected from server error by simply trying to reconnect. This is one such problem, and it’s one the developers will have to sort out for themselves, just like the bug that prevents you from moving. Then again, there shouldn’t be just yet: The open beta exists specifically to stress test the game’s servers and make sure multiplayer works without problems. It may be disappointing to hear, but there’s no firm fix to this problem. Still, by and large, this error is based on the server-side connection: The electronic route your machine takes to reach the game’s servers. It is possible to be disconnected from Back 4 Blood servers based on your own internet connection, after all. If you’re reading this guide, chances are good that you’ve ruled out local network issues. Now, the back 4 Blood players are experiencing a server connectivity issue that says ‘Disconnected From Server’ Error every time while getting into the action. That’s because some users are repeatedly being disconnected from servers. Back 4 Blood is a thrilling cooperative FPS video game from Turtle Rock Studios that’s all set to launch in October 2021 and currently the open beta mode is available. Several different solutions have been suggested as a workaround, but none of them seem to work for everyone. The Back 4 Blood open beta is in full swing, but not everyone is able to jump into the action. The only constant in each case is that the server connection was interrupted. Loads of reports across the Back 4 Blood subreddit seem to indicate that the error appears without any rhyme or reason. Unfortunately, this bug doesn’t seem to have any definitive cause. 12, 2021, and it immediately drew in droves of players who have been anticipating the game's release. Fortunately, the point of the game’s open beta is to squash bugs that randomly disconnect players from servers. Back 4 Blood was finally released on Oct. It affects different players at different times, seemingly at random. Anyway, positive thinking and all that, let’s get stuck into some of the potential fixes for resolving the Back 4 Blood server disconnected error.The disconnected from server error in Back 4 Blood is caused by server instability. If you try them all and you’re still having problems, then the unfortunate reality may be that you’ll just have to wait until the proper release of the game when the developers have resolved such issues. We have listed below a couple of fixes which have worked for some people, but not for everyone. The error also seems to be only affecting those who have the Steam version of Back 4 Blood.Īs frustrating as they are, such bugs are to be expected during a beta – this is the whole reason betas exist in the first place!Īt the time of writing, there is no one guaranteed fix to this problem. For the majority of players, this error has been encountered in the hub area of Fort Hope, though it can happen in various places in the game. ![]() The error seems to be associated with the server-side connection. out your modem, let it cool, once it has rested enough, plug it back in. ![]() ![]() The Back 4 Blood disconnected from server error has been a frequent issue experienced by many players during the Back 4 Blood beta. Tired of frequent disconnection of wifi or internet broadband connection at. Note: the Back 4 Blood open beta, free to play all weekend begins today, 12th August 2021 – read all about it here. 1/6/2024 0 Comments Tunze 6208 nano waveboxFNM agrees to such return of the products or part(s) thereof by customer.Customer returns the products or part(s) thereof to FNM in their unused & undamaged condition, and original packing to such collection point designated by FNM and must be accompanied with the sales invoice with the date of purchase and a brief description of the fault of the product(s). ![]() Customer notifies FNM their intention to return the products within 3 days of the delivery or deemed delivery of the products to customer and.Replace the same products or part(s) due to manufacturing fault.In the event that the products or parts of the products are damaged, defective or faulty (through no fault of customer), FNM shall, at its discretion: Magnet Holder up to glass thickness of 15mm (1/2").For tank sizes from 150 to 800 litres (35 to 210 gallons).Safety extra-low voltage, blocking and run-dry protection.Wave generation at low power consumption, high efficiency and low motor heat.De-sedimentation of the entire aquarium habitat.Oscillating current with near-nature wave movement and circulation.Package includes Tunze Wavecontroller 7092 and photocell. The integrated Magnet Holder enables easy attachment anywhere in the aquarium up to a glass thickness of 1/2". It also transports oxygen and nutrients to areas otherwise not reached by conventional circulation pumps. The produced wave flow is a useful supplement to directional current for suspending detirtus and the de-sedimentation of the aquarium. ![]() The Comline® Wavebox 6208 uses an original Turbelle® nanostream® pump and its very compact dimensions enable hidden installation in aquariums. The new Comline® is easy to use, elegant and small. The Comline® Wavebox 6208 includes everything required to generate waves in small to medium rectangular aquariums from 35 to 210 gallons. 1/6/2024 0 Comments Selective listening![]() difficult language skill area in L2 regardless of the target language due to its evanescent nature (Buck, 2001, 1995 Field, 2004 Graham, 2006 O'Malley, Chamot, & Küpper, 1989 Vandergrift, 1999). Listening has been regarded as the most widely used language skill in normal daily life in the case of L2 English (Morley, 2001 Rost, 2001), and yet it is also the most. Listening comprehension is an active multidimensional process of constructing meaning by applying linguistic and topic knowledge to incoming aural texts (Buck, 2001 Field, 2004 Long, 1989, Rivers 1983, Vandergrift, 1999). The study also underscored how listeners need to develop an interaction between bottom-up and top-down processes in order to progress. It was concluded that bottom-up skills ought to be taught in conjunction with more knowledge-based listening strategies to develop learners' interactive listening abilities. top-down or bottom-up), most likely to benefit from such a course. The study also found that there was no particular 'type' of learner, in terms of their predominant approach to listening (i.e. ![]() The study found that many of the learners did not develop in the manner theorized, at least over the 22-hour period of the course, spread over a semester and a half. The research employed longitudinal multi-case studies to chart the development of these lower proficiency-level Taiwanese university learners, and their progress in the course was analysed in light of the main theoretical claims of this. This study details the development of six second language learners in an English listening course that focused on developing their bottom-up listening skills. relevanCe-Identifying the factors that affect L2 listening comprehension will help Defense Language Institute Proficiency Test (DLPT) designers anticipate how qualities of created materials and selected authentic materials will impact listening comprehension. Much of the research, however, reports weak or inconclusive results, leaving the importance of many factors and interactions among factors unresolved and in need of further investigation. ConClusions-Research on second language (L2) listening comprehension strongly supports the importance of a number of factors for example, a listener's working memory capacity or the density of information in a passage. For example, expert listeners PurPose-To establish what is currently known about factors that affect foreign language listening comprehension, with a focus on characteristics of the listener, passage, and testing conditions. Familiarity with the L2 changes the extent to which the L2 listener uses top-down or bottom-up strategies in listening. These factors include the amount of prior exposure to the language, familiarity with and an ability to understand the non-native language's phonology, vocabulary size, and background knowledge about the topic, text, structure, schema, and culture. 2 In addition to these general cogni-tive abilities, a number of factors pertaining to experience with the L2 influence listening skill. ![]() 1 Further, listeners who effectively use metacognitive strategies-that is, those who are aware of and use effective strategies, such as avoiding mental translation-demonstrate better L2 listening comprehension. Factors affecting second language listening comprehension understand more of what they hear when they are listening to their non-native language. 1/6/2024 0 Comments Definition of observation![]() In general, observations are relatively cheap to carry out and few resources are needed by the researcher. ![]() In addition to the above categories observations can also be either overt/disclosed (the participants know they are being studied) or covert/undisclosed (the research keeps their real identity a secret from the research subjects, acting as a genuine member of the group). However, there are different types of observational methods and distinctions need to be made between: The devices used in these cases present more advanced technologies some examples are the so-called radiosonde, satellites and airplanes.Observation (watching what people do) would seem to be an obvious method of carrying out research in psychology. There are hundreds of stations distributed throughout the world (mainly in the northern hemisphere) and dozens of ships, from which these observations take place. * those that take place in the upper atmosphere, more modern, and used to quantitatively measure wind, temperature, humidity and pressure. Instruments used in ground-level observations include the mercury barometer, various types of thermometer, and the hygrometer. Are used to to size the pressure of the atmosphere, humidity, temperature, wind speed and direction, precipitation (both rain and snowfall), visibility and to count the clouds and deduce their position on the vertical axis. * those carried out from the earth’s surface, which outnumber those made from higher heights. In the 1950s, the first computers allowed the principles of thermodynamics and hydrodynamics to be applied to weather prediction In just a few decades, the evolution of weather forecasts has given human beings the possibility of improving their industries and their lives in general.īasically, you can distinguish between two types of weather observations: Throughout this period, the Swedish meteorologist Carl-Gustav Rossby stood out who, together with his American assistants, made a large number of important contributions to science, such as the discovery of the so-called jet stream (an air mass surrounding the Earth, moving at high speed). By observing an artistic piece carefully, it is possible to analyze the visual qualities and understand the meaning of what the artist wanted to express.Īdvances in the observation of the high altitude wind that took place during the Second World War, and also later, were the starting point for the development of new theories about weather prediction and highlighted the need to modify some of the old concepts related to the circulation atmospheric. Observation is also carried out in the field of art and consists of a detailed look to appreciate the characteristics of a work. * Finally, professionals are in a position to reach a conclusion and, in this way, continue to contribute to the knowledge of humanity. * a prediction logic, based on previous results or simply on specific knowledge, and is often experienced from these ideas * a hypothesis, which tries to explain the phenomenon studied This activity must be carried out objectively, without opinions, feelings and emotions influencing the work technique.īroadly speaking, we can distinguish three steps or stages that characterize the work of scientific observation: The scientific observation Consists of the measurement and recording of observable events. In this case, experimentation is not possible since the object of study cannot be transferred to the laboratory. The astronomy is usually taken as an example of the Sciences They are based on observation. Most of the sciences use both resources in a complementary way. Observation is part of scientific method since, next to the experimentation, allows to carry out the empirical verification of the phenomena. |
AuthorWrite something about yourself. No need to be fancy, just an overview. ArchivesCategories |